General Information

  • ID:  hor002365
  • Uniprot ID:  Q2VF17??45-51)
  • Protein name:  Myomodulin-C
  • Gene name:  MMG2
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Myomodulin family
  • Source:  animal
  • Expression:  Expressed in the pedal-buccal projection neurons in the pedal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GWSMLRL
  • Length:  7(45-51)
  • Propeptide:  MWKILETCSCFLVVAVLSGLGKAQPESFSGSAVTDDSTSGANKRGWSMLRLGRGLQMLRLGKRGGSLDALRSGHQVPMLRAGRGSPDTSGRLDANELYAVLSAILDEPRDQSRRQPPLPRYGRDNNGVARDLLDALASDGESSSNFDLLSSLNNGPSYFRPAPRGGRYKRSLPDAGPADYPSLEDYLVQSRQFARPYSSRAVALPRIGRFSGSPRLQAKAVPRPRIGRQESQMREAKSAE
  • Signal peptide:  MWKILETCSCFLVVAVLSGLGKA
  • Modification:  T7 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  MMG2-DPs (Myomodulin gene 2-derived peptides) bias egestive feeding programs toward ingestive ones, and modulate accessory radula closer (ARC) muscle contractions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9EP95-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q9EP95-F1.pdbhor002365_AF2.pdbhor002365_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 96926 Formula: C39H63N11O9S
Absent amino acids: ACDEFHIKNPQTVY Common amino acids: L
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: 41.43 Boman Index: -286
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 111.43
Instability Index: 5371.43 Extinction Coefficient cystines: 5500
Absorbance 280nm: 916.67

Literature

  • PubMed ID:  9809658
  • Title:  Mass Spectrometric Survey of Interganglionically Transported Peptides in Aplysia